Cookie Warning
This site uses cookies. Only cookies essential for site operation are used. These cookies prevent cross-site request forgery attacks, keep track of sessions and are deleted when the session ends.
sp|P80386|AAKB1_RAT 5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus GN=Prkab1 PE=1 SV=4
MGNTSSERAALERQAGHKTPRRDSSGGTKDGDRPKILMDSPEDADIFHTEEMKAPEKEEFLAWQHDLEVNEKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Set of similar protein sequences with experimental annotations
| Protein | Bitscore |
|---|---|
| AAKB1_RAT | 555.0 |
| AAKB1_MOUSE | 546.0 |
| AAKB1_HUMAN | 541.0 |
| AAKB2_HUMAN | 384.0 |
| AAKB2_MOUSE | 379.0 |
| AAKB2_RAT | 377.0 |
| AAKB_SCHPO | 129.0 |
| SIP2_YEAST | 97.1 |
| GAL83_YEAST | 90.9 |
| SNF4_ARATH | 77.4 |
| FLO6_ORYSJ | 60.5 |
| PTST2_ARATH | 57.8 |
| DSP4_ARATH | 51.6 |
| LSF1_ARATH | 48.5 |
| PTST3_ARATH | 48.1 |
| MDG1_YEAST | 44.3 |
| PTST_ARATH | 43.5 |
- Cellular Component
- GO:0005622 - intracellular anatomical structure - 0.915
- GO:0110165 - cellular anatomical entity - 0.915
- GO:0005737 - cytoplasm - 0.857
- GO:0043226 - organelle - 0.744
- GO:0043227 - membrane-bounded organelle - 0.744
- GO:0043229 - intracellular organelle - 0.740
- GO:0043231 - intracellular membrane-bounded organelle - 0.729
- GO:0005829 - cytosol - 0.607
- GO:0005634 - nucleus - 0.592
- GO:0031974 - membrane-enclosed lumen - 0.489
- GO:0043233 - organelle lumen - 0.479
- GO:0070013 - intracellular organelle lumen - 0.468
- GO:0031981 - nuclear lumen - 0.452
- GO:0005654 - nucleoplasm - 0.398
- GO:0032991 - protein-containing complex - 0.379
- GO:1902494 - catalytic complex - 0.337
- GO:1990234 - transferase complex - 0.337
- Molecular Function
- GO:0003824 - catalytic activity - 0.601
- GO:0005488 - binding - 0.462
- GO:0140096 - catalytic activity, acting on a protein - 0.423
- GO:0016740 - transferase activity - 0.400
- GO:0016772 - transferase activity, transferring phosphorus-containing groups - 0.329
- Biological Process
- GO:0009987 - cellular process - 0.701
- GO:0008152 - metabolic process - 0.682
- GO:0044237 - cellular metabolic process - 0.617
- GO:0071704 - organic substance metabolic process - 0.606
- GO:0006807 - nitrogen compound metabolic process - 0.538
- GO:0019538 - protein metabolic process - 0.538
- GO:0043170 - macromolecule metabolic process - 0.538
- GO:0044238 - primary metabolic process - 0.538
- GO:0044260 - cellular macromolecule metabolic process - 0.538
- GO:0044267 - cellular protein metabolic process - 0.538
- GO:1901564 - organonitrogen compound metabolic process - 0.538
- GO:0043412 - macromolecule modification - 0.536
- GO:0065007 - biological regulation - 0.523
- GO:0006464 - cellular protein modification process - 0.517
- GO:0036211 - protein modification process - 0.517
- GO:0050789 - regulation of biological process - 0.476
- GO:0018215 - protein phosphopantetheinylation - 0.446
- GO:0006793 - phosphorus metabolic process - 0.394
- GO:0006796 - phosphate-containing compound metabolic process - 0.394
- GO:0016310 - phosphorylation - 0.358
- GO:0006468 - protein phosphorylation - 0.355
- GO:0019222 - regulation of metabolic process - 0.353
- GO:0050896 - response to stimulus - 0.335
- GO:0050794 - regulation of cellular process - 0.330
- GO:0048518 - positive regulation of biological process - 0.326
Predictions are provided under the
CC-BY License